PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00041.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 342aa    MW: 38002.5 Da    PI: 6.2855
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00041.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.23.8e-54201461128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdee++++yLk+kv + +++   +i ++d++k ePwdLpk +k +eke yfF++rd+ky+tg r+nrat sgyWkat
  Rsa1.0_00041.1_g00016.1  20 LPPGFRFHPTDEEIITHYLKEKVFNIRFTS-AAIGQADLNKNEPWDLPKIAKMGEKEFYFFCQRDRKYPTGMRTNRATVSGYWKAT 104
                              79*************************998.78***************8888899******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkdke+l+ kg lvg+kktLvfy+grapkgekt+Wvmheyrl
  Rsa1.0_00041.1_g00016.1 105 GKDKEILRGKGCLVGMKKTLVFYRGRAPKGEKTNWVMHEYRL 146
                              ********9*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-6117172IPR003441NAC domain
PROSITE profilePS5100557.94620171IPR003441NAC domain
PfamPF023658.4E-2921146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0000975Molecular Functionregulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVDEGGVVVN QGGDQEVVDL PPGFRFHPTD EEIITHYLKE KVFNIRFTSA AIGQADLNKN  60
EPWDLPKIAK MGEKEFYFFC QRDRKYPTGM RTNRATVSGY WKATGKDKEI LRGKGCLVGM  120
KKTLVFYRGR APKGEKTNWV MHEYRLDGIY SYHNLPKSAR DEWVVCRVFH KNAPPPTTIA  180
TPTNQLTRID SLDNIDHLLD FSSLPPLIDP GFLSQPGPSF SGAGQQHDFK PIPHHPTTVQ  240
INNTYPSAQT LNYPYHSVPT YGFGSGSGTS LGNNNNGMIK LEHSLVSVSQ DTGLSSDVNT  300
TATPEISSSY PVMGNIAANA AMVDGNNTSY DDDDLGIFWD DY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-501817315167NAC domain-containing protein 19
4dul_A1e-501817315167NAC domain-containing protein 19
1ut7_B1e-501817315167NO APICAL MERISTEM PROTEIN
1ut7_A1e-501817315167NO APICAL MERISTEM PROTEIN
1ut4_B1e-501817315167NO APICAL MERISTEM PROTEIN
1ut4_A1e-501817315167NO APICAL MERISTEM PROTEIN
3swp_D1e-501817318170NAC domain-containing protein 19
3swp_C1e-501817318170NAC domain-containing protein 19
3swp_B1e-501817318170NAC domain-containing protein 19
3swp_A1e-501817318170NAC domain-containing protein 19
3swm_D1e-501817318170NAC domain-containing protein 19
3swm_C1e-501817318170NAC domain-containing protein 19
3swm_B1e-501817318170NAC domain-containing protein 19
3swm_A1e-501817318170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAPTransfer from AT3G04060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013639829.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ24e-93NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D3AFP50.0A0A0D3AFP5_BRAOL; Uncharacterized protein
STRINGBra040153.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22692775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04060.10.0NAC domain containing protein 46